DPCstruct | MC62964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A422P3Y7 | 149-223 | ILVLGDVAREYGVTVEVLVKVIETLLADGVISGVFDDRGKFIFVAEAHYLKLALFIQQRGRVSVKELVRECNRVV |
| A0A0V0WV75 | 370-468 | TLLFSVCILMYNDRFISIVNQLSISFVVSMEELAGQFQMRSIDVIDRLKNLLADGMLTGVIDDRGKFIFVTEDEMKAIVTFVKQRGR… |
| A0A5S6QQS9 | 689-811 | None |
| A0A0V1AAY3 | 255-380 | None |
| T1FTE2 | 447-572 | None |
| A0A7S0UL22 | 3-120 | None |
| Q55CM7 | 204-325 | None |
| A0A0V1DES6 | 460-550 | None |
| A0A1L8HSI4 | 659-762 | None |
| A0A835WWV9 | 97-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.