DPCstruct | MC6296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 303 ± 85 aa |
| Standard deviation of domain lengths | 85.43 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4CZT5 | 161-659 | LDIYEAKTKGLLSPDMALILLEAQAATGFVIEPIKNSHHSVEEAAKEQLIGPDLLEHLLLAEQAVTGFTDPYTGEEIALLEAIKKDL… |
| A0A1S3QY14 | 2-188 | IAGVYVQSTKQTMSIYEAKSKGLLTPGTSLVLLEAQAATGFVIDPVKNKKLSVEEAAAQGVVGNEWKNKLLSAERAVTGYKDPYTGN… |
| A0A6G0HU43 | 17-334 | None |
| E4YEV7 | 607-970 | None |
| E4Y9Z6 | 100-338 | None |
| E4XKP7 | 585-850 | None |
| A0A3M0LBS4 | 105-532 | None |
| A0A3M0LAH0 | 122-491 | None |
| F1Q4X8 | 1690-1971 | None |
| A0A3Q7UG82 | 93-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.