DPCstruct | MC62952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 272 ± 52 aa |
| Standard deviation of domain lengths | 51.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3K5N7 | 11-262 | VLALWLLVATWQAASWAAPSPETASPPSSGANAALYYYQAFELMPPTLKSRTISGALQSGTHYPLNKAVQAYVRASRNSLRLARFAA… |
| A0A7C4C8X2 | 320-518 | LNSFADVTGPNAAALYEQAFAQFVPFAGNGDLLWAALRGESAALAAPEIRAWIAANAGALEAFRAAGLQDACGWTYHSSDGTLLGVL… |
| A0A7C4V4T9 | 15-264 | None |
| A0A5C5VS77 | 263-604 | None |
| A0A5C5ZEQ2 | 229-437 | None |
| A0A7C4UPS0 | 1-383 | None |
| A0A2D5B6L3 | 4-234 | None |
| A0A166VR43 | 18-271 | None |
| A0A4P5XQU6 | 21-365 | None |
| A0A4P5WYH3 | 128-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.