DPCstruct | MC6295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FK53 | 162-227 | RVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLA |
| A0A3B4CJT2 | 1-77 | CRVISIKRYCPDTRVIVQMFKHSSKAYLQNVPNWDWSRGDAVICLAELKLGFMAQSCQVPGLSTLLANLFTMQSKVE |
| A0A183R6M9 | 32-97 | None |
| A0A5J5CSH7 | 329-394 | None |
| A0A1B0A8U3 | 115-190 | None |
| A0A553NRQ4 | 644-719 | None |
| A0A1A9XMY3 | 65-141 | None |
| A0A0F8CIX3 | 415-490 | None |
| A0A183KQG6 | 237-312 | None |
| A0A663MIT8 | 17-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.