DPCstruct | MC62946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 594 ± 47 aa |
| Standard deviation of domain lengths | 46.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X8JCS1 | 44-620 | QPELAEKVLSVLPLYMESLTFDNQLHINFFKQLQEKGILPVEAFVTAAFEALLAPRKKPVLDLLCRLIEVLHPSNALLLCNQERMLA… |
| W7VRK3 | 2-532 | TWLDRLARQHPDQATEVGAVLAVAAGHPDAGLRERALALAARHGHRPEAVTTVAEPRDDLPPPLPAAAAPPPIADVDELVEEVAATL… |
| A0A4V2YRU1 | 173-699 | None |
| A0A3P1WVP2 | 81-615 | None |
| A0A496PHN9 | 199-842 | None |
| A0A3P1WSK1 | 214-857 | None |
| A0A7Y5XHL1 | 2-614 | None |
| A0A850DI60 | 3-598 | None |
| A0A2T0R4M7 | 183-833 | None |
| A0A7Y6I2E4 | 2-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.