DPCstruct | MC62939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 230 ± 25 aa |
| Standard deviation of domain lengths | 25.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5HPR2 | 1-182 | MMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTSSYEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNS… |
| E0AHC4 | 2-233 | TNSDDEDLLRQQMDVHQMIGHHHGSTDTGGETPPQTADQVIEEIDEMLQSCDFTGSMMTDRTMESVDSMYSSMRSPFPSSIQSSDAD… |
| A0A6J3EM03 | 89-337 | None |
| A0A7R9KNE8 | 188-392 | None |
| S4RJ33 | 1-256 | None |
| A0A139WJ27 | 658-874 | None |
| A0A2H2HVQ9 | 85-321 | None |
| A0A553PPZ4 | 768-983 | None |
| A0A6P4URS7 | 156-392 | None |
| U3KBB0 | 34-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.