DPCstruct | MC62936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1567 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 33.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 16.50 |
| Pfam Score | 99.62 |
| Assigned Pfam label(s) | CL0023- CL0062- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K3AVB2 | 16-222 | NRSELTRSLGSCSQLNNKLDIINTYTTPCDKTKFTTCFAYSAYLKDRNAMVIVFRGTTSLSQFIDEGISFFFLPKVPFNVTKGVVDQ… |
| Q9SU72 | 18-203 | WSASKQAYLTERYHKEEAGAVVIFAFQPSFSEKDFFDPDNKSSFGEIKLNRVQFPCMRKIGKGDVATVNEAFLKNLEAIIDPRTSFQ… |
| A0A0E0I0L8 | 300-571 | None |
| A0A7M5UNB2 | 38-261 | None |
| A0A1S8VLX9 | 323-516 | None |
| A0A318Y6T5 | 531-803 | None |
| K3WDS6 | 4-189 | None |
| A0A1Q9CKD7 | 526-713 | None |
| A0A7N2LA55 | 15-207 | None |
| A0A1Q9C6M4 | 524-747 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.