DPCstruct | MC62934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 137 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8MQT4 | 17-150 | VAGIAHAQFSKPEDAIRYRQSVMVLIVHHFKQMGAVVQGKANYDKASFEDHTKLVHTLSTMPWEAFMTPDSDTGKTDLEPSALKNKD… |
| A0A645EZD3 | 2-125 | IRYRKAGYAFMNWNMAKLKAMLDGSVPFNKDQALAATTSINSTVNSGMGALYTPGSDKDAGNEKTRLKSEFFTQPDKVKEVAGAYRV… |
| D3SFU5 | 1-186 | None |
| A0A2T8HQH8 | 86-230 | None |
| A0A523CL41 | 3-149 | None |
| A0A6M1LLT5 | 1-146 | None |
| A0A355AWP7 | 2-115 | None |
| A0A258S8K0 | 3-105 | None |
| A0A517QGP2 | 13-146 | None |
| A0A1E3H0A2 | 11-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.