DPCstruct | MC62930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3E0K0 | 20-120 | DKNFRKKQAKWPKLAASIAIDAVGVSSYAFPGIGETEDVVWGPISAALVQFLYGSYWLSALDLLEEGLPFTDFLPTACLAWSLEYTQ… |
| F0YF45 | 8-98 | ITTSSWAKLVGCVVLDLLGDTSELIPFLGEFTDIAYAPVEASVLKALFQSNTIAAFGFVEEILPFTDVIPTFTLSWCLATLWPTTPL… |
| A0A1G6Q908 | 3-90 | None |
| A0A838YP01 | 7-105 | None |
| A0A2P6NVR4 | 106-212 | None |
| A0A7S0IVY7 | 67-190 | None |
| A0A6U4UC24 | 136-258 | None |
| A0A812UKZ3 | 40-138 | None |
| A0A7S4A5C9 | 61-186 | None |
| A0A2P6NLM3 | 26-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.