DPCstruct | MC62927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 244 ± 43 aa |
| Standard deviation of domain lengths | 42.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2Z7L3 | 12-223 | IGMPSGDHFYTYYQSCDGQNIFLHPLTYAVLTNHYSDLGQAPLTLKAPVLEIETLVQTEETRRRWRFLSHLPLSSTLRLCELELKND… |
| A0A7J7PG19 | 170-330 | MYQAADGQWLFLHPLNLRCLLHAYGSYAACPPLVTGKVLELEDMVQDEACRRRWKFLSHLPLHGTFRLGEAALLQPQLTPDELAPFA… |
| A0A1Y1L2H3 | 1-252 | None |
| A0A0P0VJJ5 | 201-440 | None |
| A0A6V7Q0I0 | 203-456 | None |
| A0A2T7A212 | 91-358 | None |
| U6N281 | 429-760 | None |
| Q6CFV7 | 259-436 | None |
| A0A2H9TLA0 | 361-583 | None |
| A0A7J7WLG1 | 3-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.