DPCstruct | MC62925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2Z461 | 9-70 | VSPCAICGGQAQAPHLNCANVDCNKLFLACDKCRPKYYGCCCEACTRAPRLLRPIKKEGYYA |
| A0A1G1P0R3 | 43-112 | IARCLITGAACDRYINCANPDCNRLFICSQEGARRMNGCCSAECLNAPRKRPFDPDDVYAPSKKRHLYFD |
| A0A835RQV7 | 355-433 | None |
| C1N3F0 | 438-506 | None |
| A0A2N9GKS0 | 274-359 | None |
| A0A7J7QNB9 | 376-454 | None |
| A0A540M690 | 160-234 | None |
| A0A7W1GZV4 | 1-61 | None |
| A0A2H9ZY59 | 820-901 | None |
| A0A834LA64 | 585-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.