DPCstruct | MC62923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 111 ± 30 aa |
| Standard deviation of domain lengths | 30.09 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7EB14 | 96-187 | SIRFAQMERTLGEIDRARAIYAHCSEICDPRVHGMFWEIWKEFEVKHGNEDTVREMLRIKRSVQATYNTNVNIMSAQMLSTAAGAVT… |
| A0A7S2YYE0 | 10-131 | MCLRYAQLEKKLGEIDRARAILRHGAQMANPKQDRAYWADWNAFEVAHGNEDTFREMLRIKRSVAAFYSEANQSMLGAMAATAAAAG… |
| A0A1C6YQN9 | 810-905 | None |
| A0A1E5UTK6 | 244-364 | None |
| A0A835J0W3 | 1-101 | None |
| A0A6J5UJU6 | 54-141 | None |
| A0A7N2L7S9 | 520-598 | None |
| A0A7J6WAB3 | 1-108 | None |
| A0A0C9VYT8 | 158-304 | None |
| A0A060X482 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.