DPCstruct | MC6292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CNE5 | 351-444 | DQKALDWIFDEVIERDEISEVSYPKLRFEAVQLLIRMPPFQRGEAGSRLDTPQLVERLWTLMNYGCSGDSRLRSAVADLYHILYGNR… |
| A0A814DY51 | 1-115 | MNQSVLDYIFKLIENDPDYNLRRKIVQHLCRHPPFRQNQTCTLNNPTTVHKLWSLMTNCAYDNQTRNDLGELYQIMYGLNRPNCLPT… |
| A0A812DAD1 | 211-298 | None |
| A0A811UXL3 | 135-230 | None |
| A0A5K3EV67 | 496-594 | None |
| A0A7R9DPP0 | 26-135 | None |
| A0A820X6V3 | 596-707 | None |
| A0A498M1I2 | 151-240 | None |
| A0A820T1X3 | 219-330 | None |
| A0A3M7SC32 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.