DPCstruct | MC62917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 22.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4X187 | 3-126 | LEFIVIDLARILDESAQGRAAARELAGLWQSGEADVRAMIRAAEAQQGESRDAGFREAAAAEQSLNNRVDAARRDAREALLDRARPI… |
| A0A1Q6FVF1 | 1-145 | MNFSELIQLCPEADEARTTMAAASQEAQDTYQAMVDEFQTKYQDYEAKAATWSDSIRSSKEKELTDIQTRIQEFSQSVDLELQQQQQ… |
| E6UZK7 | 4-135 | None |
| A0A2N2KSS3 | 15-180 | None |
| A0A381CBW1 | 2-125 | None |
| A0A7V4YW13 | 4-159 | None |
| A0A821SWF5 | 1-136 | None |
| A0A258GW93 | 17-188 | None |
| A0A1H3X348 | 8-172 | None |
| A0A8B4QRP2 | 8-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.