DPCstruct | MC62914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849UEG8 | 2-118 | PLYQLEAFQKLVVTNGWQFLNKKRCLRTQEDLGWSDEQIEAFLLGIQISDFQKTVPNNIVNDLAGQDFVNADQYAVKWCEENMVHAD… |
| A0A2N3F169 | 106-201 | PHYELAAIKRLVTCGQFGRTTRVARHVRSRGWGDQDITRCFEQMLASDFHKTQRHRERPGQWLDIYRPWIDGVRMYVKFTVDTDGSV… |
| A0A6I1KN48 | 18-121 | None |
| A0A356K210 | 14-118 | None |
| A0A857IP55 | 28-166 | None |
| A0A839V8W3 | 5-109 | None |
| A0A1F6LNL3 | 4-102 | None |
| A0A5C5C879 | 4-118 | None |
| A0A5K7Z1Y5 | 28-142 | None |
| A0A2G6RK41 | 76-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.