DPCstruct | MC6291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 264 ± 70 aa |
| Standard deviation of domain lengths | 70.36 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15636 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814DUS8 | 10-233 | SRNSFLYTSFFSYFNDYYSISYPNQFTYSIAHIQNENDFWINRTLSRKNSSNQIEFFSFTSYDEVFSRLFNQSYIIPYRKQNDIYFL… |
| A0A498P734 | 1-195 | MLALYKGIVITRALSLANEDCVKVANILNGALYLKDLHFIVDGRDTHFFVKMNSPEADLAALRLTSGRKELENAVNVTVSQSTAVLG… |
| A0A2A3EIS2 | 436-715 | None |
| B7P2D5 | 46-269 | None |
| A0A0P4WGH0 | 12-211 | None |
| A0A1I7WF41 | 537-815 | None |
| A0A7R8CW90 | 4-189 | None |
| A0A4Z2EQT6 | 21-273 | None |
| A0A182TR01 | 53-384 | None |
| A0A2A4K3X2 | 16-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.