DPCstruct | MC62903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845YIC2 | 42-159 | IATPGQASAPTPIPKTIPLGWIRIGAVDNTLGIAPTGETLIATSQPVTIAPVKVPKINSSVVVITGVNLRSDYPKPPGYDLHEKISV… |
| A0A511UUN6 | 238-320 | SVGDKGWSYAGKFSGEKWLGRFFSFGENDLPAEGDEVSILYPVNLRNGPSVSDNSIGQLRLNQKVTVLDSFSSDSENYWIEAE |
| A0A7C3CU47 | 166-275 | None |
| A0A4R9S4H7 | 13-123 | None |
| A0A0A1PH79 | 647-747 | None |
| A0A1G2L598 | 61-181 | None |
| A0A8A9EP90 | 124-242 | None |
| A0A433ULB3 | 455-572 | None |
| A0A369TW24 | 1-183 | None |
| A0A6S6SPK6 | 101-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.