DPCstruct | MC629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 204 ± 29 aa |
| Standard deviation of domain lengths | 29.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840ZHG3 | 2-159 | IQELRDIADYIAKLRDAIGLLRANELTRDRLPMVHEELGEVVAATAGATNTIMSSAETILGLADGPGYRAAVEARIFDIFEACAFQD… |
| A0A5F1IUG7 | 16-213 | VFTRIGNITRMLRDSLVSLGLERTIMDAAEAIPDARERLNYVAKKTSQAAERVLNSVEETRPMQDAISSGAEQLTQRWDAWFDAPVE… |
| A0A1F8XL42 | 4-190 | None |
| A0A437LTP0 | 2-159 | None |
| C1DB75 | 85-314 | None |
| A0A1M6CBD6 | 301-533 | None |
| A0A0A0BHJ3 | 39-244 | None |
| A0A378XGH8 | 15-219 | None |
| A0A1T4VF76 | 37-252 | None |
| A0A3T0K6G2 | 4-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.