DPCstruct | MC62899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845YD67 | 1-63 | TLTIPTIGIGAGPHCDGQVLVTSDLWGLSAWQPSFAKPLVDLRSQAIQAVKQFCDRVRQPDSV |
| A0A512U827 | 503-564 | VSVPVIGIGAGPHVSGQVLVMADMLGMNDKTPAKFVKKYLDFHTLSQNALAQYKADLADGSF |
| A0A212DQT9 | 1-73 | None |
| A0A2S8S1M0 | 26-117 | None |
| A0A661JB65 | 113-183 | None |
| D3AXV1 | 310-379 | None |
| A0A2D6UF24 | 147-210 | None |
| A0A127SL55 | 124-196 | None |
| A0A662XF51 | 162-240 | None |
| A0A812QKK4 | 199-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.