DPCstruct | MC62892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 195 ± 39 aa |
| Standard deviation of domain lengths | 38.87 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014MZW0 | 4-229 | ERLSTEKALQFYTVLSEQIEQIQANFQKHQDSDLTSGMHFGRGLQGCMHHMCFMLARLEKYQKIVAGRLNTRLNAESAEEQASFDKL… |
| A0A319A1C2 | 1-132 | MYKDPTNLNLIKEERESIIQCLNVCSEASELAHRARTNIFEDVTSSDESHQLVVSTIGDLISAKHIITGSKSAQWLGQMSDTSLQQL… |
| J3PF73 | 89-239 | None |
| A0A4V1X8S8 | 143-330 | None |
| A0A094HEF0 | 207-402 | None |
| W6Y3R9 | 14-261 | None |
| W6XQX7 | 1-149 | None |
| W6QPT7 | 97-312 | None |
| A0A4Q2UY56 | 1-189 | None |
| A6R0C5 | 69-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.