DPCstruct | MC62890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9D192 | 2-70 | VAALIAIVLVIGGRWYAYVAYANDPFDEVGIGLNSMMPGPIREKGCEMLKARFENKTLPPAGCGVNGAW |
| A0A840LTY6 | 9-79 | MIMAIAGLVIFGSRWYNYVTNTESPYQEVGIDINSRLPDPFNKWGCDRLHATFGNVLPPYGCQSPTDARQW |
| A0A4V6NIS6 | 46-124 | None |
| A0A7R7T6U4 | 2-66 | None |
| A0A179BL12 | 11-89 | None |
| A0A543NQJ5 | 111-180 | None |
| A0A0K6HZ57 | 53-143 | None |
| A0A1M7Z8T4 | 1-72 | None |
| A0A444LGW9 | 307-376 | None |
| Q2K0R2 | 26-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.