DPCstruct | MC62879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7NFK8 | 48-125 | DVNWHDSVVINGVFFFIANDGIHGPELWRSDGTTDGTRLVKDIRPGVDGADLSRFHVVGDVLFFVANDGVHGHELWRS |
| A0A7C5AD84 | 211-300 | AGSNPSDLAVVNGVLYFQADDGVNGAELWKTDGTPGGTVLVADIRPGLLSSSPRFMTGFNGNVYFQADDGMAGRELWVTDGTAAGTA… |
| A0A2E7WAS7 | 18-113 | None |
| A1ZSF2 | 24-135 | None |
| A0A2N1TBK5 | 287-414 | None |
| A0A7J4NA11 | 1-78 | None |
| A0A534I737 | 133-219 | None |
| A0A832BBD8 | 38-159 | None |
| A0A218Q2F2 | 23-117 | None |
| A0A517NWP7 | 798-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.