DPCstruct | MC62878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 164 ± 26 aa |
| Standard deviation of domain lengths | 26.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | PF04290- CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7HHL4 | 14-141 | SGMIFFLQQPTLPLTIPVQLVLTQTQSFVLLAIPLFMFAGNLLNESGITYRLMKLSSVLAGHMRAGVAQVNTVLAAMMGGITGSAIA… |
| A0A3D4EGW7 | 5-183 | ILIGVFVVLLISGLPVALCLGISALVSVLQMDLPAMTLAINSNAALSKVVLEAIPFFILGGNIMEKSGISRKLIDFASAFVGHIKGG… |
| A0A101FL54 | 1-122 | None |
| A0A379GIZ6 | 2-153 | None |
| A0A1E3GYE0 | 239-371 | None |
| A0A0E8C4B8 | 1-144 | None |
| A0A562ER74 | 2-132 | None |
| A0A0B8NVU8 | 220-385 | None |
| A0A1Q9C216 | 441-674 | None |
| A0A4U5JA94 | 146-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.