DPCstruct | MC62877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4XYH7 | 2-86 | RVSDQNEVEGIPLVPDPSAARLDERHQQDYRAHRSQLVQWLLAFGKDPETAEGYAHRTVLNTVQRLDIFYRWAWETGRIHDQHQP |
| A0A897NBT7 | 17-108 | KIRGISVVPEPSRERLGERELIDYGQHRTDLLRWAFDVGKNPDRAEGYAQQTVFGRAYRLDQFSRWVWDEYDGYTTNITHSYADDYT… |
| M0F2C5 | 1-87 | None |
| V4XU49 | 13-92 | None |
| A0A2R6LUJ7 | 1-86 | None |
| A0A830EQ72 | 1-85 | None |
| A0A368NDR2 | 13-84 | None |
| A0A2R6LEN4 | 1-76 | None |
| A0A256H2Z0 | 2-92 | None |
| A0A7D5T813 | 13-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.