DPCstruct | MC62873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 224 ± 43 aa |
| Standard deviation of domain lengths | 43.21 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 56.77 |
| Assigned Pfam label(s) | PF06883- CL0410- PF04563- PF04567- PF04565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O28392 | 1-173 | MRKCRVYINGALVGFHDNGEELANKIRELRRKGRISNQVNVVYYPDSNEVRINTDAGRARRPLIVVKDGKPLVTPEHIEKIKKGELT… |
| A0A6P5RJD1 | 23-223 | THVTTDEEESPLISLCYCLGVEGLEVLSGEELHTPYSFLVLFNGNILGKHRKPQHFAAAMRKLRRAGKIGEFVSVFVNEKQHCVYIA… |
| A0A2K3NLS5 | 1-190 | None |
| A0A6S8SMV0 | 231-475 | None |
| I1CVV8 | 474-749 | None |
| A0A7S0MES3 | 83-355 | None |
| A0A835Y177 | 568-789 | None |
| A0A1A9VXS4 | 2-188 | None |
| A0A0B1PSN9 | 89-348 | None |
| A0A5E4QCT5 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.