DPCstruct | MC62862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 167 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AXD0 | 9-193 | RNFIIPTKTDRADKFGNIVQAKQEMGMTKEQQEEAKRNYMATVARSIDIPANNLASLKEKIRILHQKICRIEADKYDLEKRQERQEY… |
| A0A0M3IIA3 | 1-120 | MEMTKEQQKQEKENFLAAIAKTLDFNELKGIELKEKIRQLYQRICKLEADKYDLERRKERQEYDLKELNERQRQVFRNNARKKGIDP… |
| F1L7C2 | 1-158 | None |
| A0A183TX17 | 2-154 | None |
| W2SZZ2 | 125-300 | None |
| A0A023EPH6 | 139-281 | None |
| E2BCA9 | 127-299 | None |
| A0A0B2VC98 | 294-501 | None |
| A0A0R3Q3I2 | 66-210 | None |
| A0A6V7TYK1 | 226-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.