DPCstruct | MC62859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 493 |
|---|---|
| Mean domain length (aa) | 135 ± 26 aa |
| Standard deviation of domain lengths | 26.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 99.84 |
| Assigned Pfam label(s) | CL0511- CL0265- PF13865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AGL5 | 8-133 | EECYKCHEVGHFARNCPNQSDGARRGGGTGECFSCGRKGHFARECPNGRHPGGYGGYGVRSRNTECYQCGGMGHVARECPSSRRGSS… |
| A0A0D2FHU8 | 216-330 | PAVCLACLRADHTEQLCPEKTCQYCAAVGQHSSRLCPKIRRCAKCRERGHTAESCTANLGVTTVPCDLCGSLKHLEDACPHRFFPAE… |
| A0A7S4RRJ9 | 157-264 | None |
| A0A6J1A8A1 | 249-414 | None |
| A0A819Q6H4 | 87-214 | None |
| A0A0N1I8Z8 | 5-107 | None |
| A0A397EZL3 | 183-293 | None |
| A0A1S3P8R7 | 10-123 | None |
| A0A4Z0Z603 | 120-264 | None |
| A0A673WA36 | 15-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.