DPCstruct | MC62855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 48.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5A8R5 | 1-170 | MTGGAGEGTQRLRPESNFEEREQVKTDSVLPAYCDPPNPCPVGYSAADGCLEDFDNTAEFSRMYQSSQNCACDREHMFNCPSKGIDE… |
| A0A444SIY5 | 64-166 | GGNGKTLQRLKPTANGNKATSELKADGVLPAYCNPPNPCPLGYTAEDGCLESFENTASFSRDYQAMQECMCDTEHMFQCSDSTRDSE… |
| A0A154NXK0 | 64-187 | None |
| A0A0B1TLC5 | 1-100 | None |
| A0A3P7F198 | 66-191 | None |
| J9F9J3 | 20-133 | None |
| A0A132AEA3 | 132-258 | None |
| S7QFA8 | 37-165 | None |
| A0A7E4VUY2 | 66-210 | None |
| A0A0R3S2Z8 | 20-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.