DPCstruct | MC6285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HSF6 | 109-249 | DYCLMGCVEPQKSGRIYQWNSTGYTQWPIAIEFVLNRGRMVLFDSYQGLDTGDLRDLRTFDEFDAAVKQQIAHIVRLSAIGTVISQR… |
| X1FQI7 | 216-360 | MIAEGIPKEDAWDYACVGCLENTMQGNDRSGTVNCNPNLAKSIELTLWNGKNMPDKSDTSKSREQFGPKTGDPENFETWEEFWNAWF… |
| A0A376TS05 | 9-136 | None |
| A0A376SH13 | 73-200 | None |
| A0A827JIE1 | 419-550 | None |
| A0A2V1JUV2 | 448-588 | None |
| A0A1Y1UIZ4 | 279-433 | None |
| A0A6G3I5S2 | 292-428 | None |
| A0A1Y1UIT2 | 81-215 | None |
| A0A1V5GIN8 | 290-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.