DPCstruct | MC6284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9G0F3 | 133-199 | EPEFRFTPEQIEAYTTVGGTPHLDGEYTVFGEVVEGMDVVDKIQQVKTDRNDRPEEDVKIIKATILE |
| X1FL32 | 7-87 | QEAAALKTEEEFAKLTPYIIPENHRFVYKTIGGTPHLDGSYTVFGEIVEGLELIDKIASVKTDDFDLPLENIIIIKMKRVR |
| A0A7V3CTE8 | 82-150 | None |
| A0A0M3CL37 | 2-68 | None |
| A0A6C0RH33 | 39-113 | None |
| A0A7W1UNU4 | 42-116 | None |
| A0A2T4DIJ7 | 3-80 | None |
| A0A388Q816 | 2-69 | None |
| A0A0E9LUT7 | 33-108 | None |
| F3QX20 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.