DPCstruct | MC62834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 203 ± 28 aa |
| Standard deviation of domain lengths | 27.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839MKT9 | 33-218 | TVDPASRKEWDKQKEAVTQLRDNLQKKVDGFNAKAKEKGWNAEKLAGKIGNLTDRIGSQGSSLENLGRLEGSQQNYSLKKIDAEESS… |
| A0A3P1SJ13 | 4-187 | EEGSLKEWAKLKQRIEKQRDKLESDINKLNAKAEAKGWSSEKLAGKIGNKAERLASLNSSIGTMGTLEGSTQVYSLSHTGYGENGGV… |
| A1ZJA1 | 94-287 | None |
| A0A0D6TME4 | 10-213 | None |
| A0A3M1SKZ1 | 27-276 | None |
| A0A3R8UD17 | 52-234 | None |
| A0A2T7QER1 | 236-462 | None |
| A0A2T4HG56 | 5-189 | None |
| A0A355BRP9 | 244-485 | None |
| A0A1B1I7V4 | 157-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.