DPCstruct | MC6283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1PF37 | 8-80 | SLEKFLKNESSAGILLVAASVLAIILANTPANQFYVLLIDIPLAIQVGTFKISKPLLLWVNDGLMTIFFYWLA |
| A0A5R8MKF0 | 11-100 | ERTAGLVTVGAMVVALMLANSPLSDFYQLVHHTPVSVQVGTLSIDKPLILWINDGLMVFFFLLMGVELKREMLGGLLGSARQGVLAT… |
| A0A6M0IRV5 | 8-106 | None |
| A0A3N5X5X7 | 16-119 | None |
| K6WC69 | 17-118 | None |
| A0A7K2BMH8 | 51-173 | None |
| N6Y5P8 | 22-120 | None |
| A0A1Z1WPC3 | 12-134 | None |
| A0A841MJC9 | 7-121 | None |
| A0A1S6XP13 | 20-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.