DPCstruct | MC62826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 195 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3AZ11 | 1-219 | SASGECLEDVYVADFCNLNQYMFNLCIKAIMICLTYINFLPIPWRVAIGVDAWGDALTDRGRHEPPGLDFYGRETEALWFHIPRHRR… |
| A0A7S3BQ32 | 117-279 | EKSTQVLSGLFTYACGVTVPWRMANTFHLLGGKASVGKDFYGRPSPALWFAIPPRKRAYIVVFLVSNAVLQFAHQVLHITNNTYQSS… |
| A0A7S3F8Y8 | 54-265 | None |
| A0A6T9CBQ2 | 1-223 | None |
| A0A7S1D2U5 | 17-174 | None |
| A0A7S4DZS5 | 96-267 | None |
| A0A7S4M399 | 143-365 | None |
| A0A0M0JUM4 | 57-263 | None |
| A0A0M0JH79 | 60-260 | None |
| A0A0L0GCM1 | 157-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.