DPCstruct | MC6282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 22.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2ZQR2 | 2-145 | QNDIYMKEQNKKELLAQFYADLANGYAHKYGMDEFVGKTLDKALEYSPKNIYANLLKSTFQQAKLEYVAGQLGIKNLENPEELQNIR… |
| A0A3P1SFN3 | 130-258 | IEDSAIIAKTYLSPLTDKETVACQLSDLALAYYHKFSRYDEFTLRCVDASLKYYPMNPNAIITKGKSLDVLLQRHLEQNGHLRDEYT… |
| A0A3N7D9A0 | 102-283 | None |
| A0A5M6CFD0 | 1-173 | None |
| H1XZG1 | 184-329 | None |
| A0A2W5I8C5 | 55-199 | None |
| A0A3D4CIY2 | 190-321 | None |
| A0A1M3R361 | 6-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.