DPCstruct | MC62819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13299 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3AD85 | 59-126 | QFLSDGDVRLADLKQLLVRSGFHAEFSDGSLVVDQSVTVRRGPAQQLVVEGSYGSTYLSVRRLLYEQF |
| A0A7S4K0V6 | 405-477 | VMISDGDVLLTDLRSEVIAQGMKAEYSAHAGYSQLLVNGKVVVRKDLATGKIGVEGPLCQDFFAVRSVVCGQY |
| A0A433QM13 | 536-629 | None |
| A0A095A7Y3 | 631-741 | None |
| A0A7R9P511 | 330-432 | None |
| A0A183LXJ0 | 629-705 | None |
| A0A1R3HN46 | 1-72 | None |
| K8EQ87 | 993-1092 | None |
| A0A0M3IHG1 | 208-318 | None |
| A0A5J4Z843 | 704-780 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.