DPCstruct | MC62817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3AIH2 | 1-116 | PMEAPSFDSLVDKEIEVRWRYWVKDPSRKSGRRAQYIWCAGTVVEVADGRKKRSPKCKSPLPWGAVRIRWPEDAAYAEGETYVWSVL… |
| A0A6T9KI44 | 44-158 | QPPEAPLFDSLVGKWIGVRWRYKVPCATNKSGFRQEYIWCTGEVVEVADGKSTKRTPGCKSPLPWGAVRIRWPEDKSREVPEPETFV… |
| F0YSR6 | 19-151 | None |
| A0A7S3APL3 | 166-279 | None |
| R1FAF3 | 15-178 | None |
| A0A7S4I4I3 | 13-175 | None |
| A0A7S4HCW7 | 706-864 | None |
| R1BVI6 | 156-304 | None |
| A0A7S2GGZ6 | 1-116 | None |
| A0A6S9ZEC6 | 285-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.