DPCstruct | MC62813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9RIA5 | 26-157 | YSTTYNNTAEIKKDLTAIPDGRNPKGAGRKPKMVKNPYIQEFINLVGDRLPQWLDDVIYGAGTHHESGNTRIPLRTLRTLLQSQEEF… |
| B1JBZ8 | 98-233 | LAPVIELCHHEQTSEVRTSSTRGPKPQLTDNPLAPALCILKFEERPTPWLDDIVFGAIYTGPGVIAGKHSASLPDVMSVLRLSVISI… |
| A0A3D9XK79 | 57-232 | None |
| A0A8B3SXJ2 | 49-204 | None |
| A0A0P9RCN1 | 1-176 | None |
| A0A0Q8YS68 | 1-166 | None |
| A0A5F0JMC9 | 19-174 | None |
| C5CLR8 | 1-149 | None |
| A0A5U9IAT6 | 3-131 | None |
| A0A7W4LMM3 | 77-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.