DPCstruct | MC62812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 290 ± 25 aa |
| Standard deviation of domain lengths | 25.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A248KH48 | 81-357 | LAFLRSVENEEFNNLCKQSSRIVDHYFQAMLERERERQDLLMTPEKQASILTMVALDMCENDYTSDNRDKIVSLIKNKSLNILEDTR… |
| A9H7I2 | 8-295 | ALRPFFLSELARDGVAQQIQDGDIGDLLSFLILAMTKREATKFGRDVEAVTTTESRAEFITQVMEEIARDLAENQSSAIPSETVAWL… |
| A0A6S5PAC6 | 81-376 | None |
| A0A5E5PRE3 | 16-289 | None |
| K0F824 | 908-1171 | None |
| D1BAG6 | 616-952 | None |
| A0A4R5H812 | 607-926 | None |
| A0A8B3S558 | 721-980 | None |
| A0A347Q9R6 | 688-992 | None |
| A0A6S6TJQ1 | 637-941 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.