DPCstruct | MC6281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848SWG4 | 1-57 | MPKKKPKKGKPKVHKDLEGFEININEFGELKSNTSVEELNKFLNKKVDDKKLRDRDD |
| A0A1I2GY70 | 13-70 | KKPKNKVENEEKPKVHPDLEGFDVKINSFGEIVSTHSIEKINEFLNKNVVDKKLKDRD |
| A0A0H4VNZ1 | 1-74 | None |
| A0A7Y0AGD6 | 7-64 | None |
| A0A1G9DLA7 | 1-62 | None |
| A0A7Y4V844 | 1-55 | None |
| A0A1W2GCJ9 | 1-59 | None |
| A0A316E415 | 1-57 | None |
| A0A1I2F466 | 4-64 | None |
| A0A7G8ZTB0 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.