DPCstruct | MC62805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537XZB7 | 1-121 | MKKFRSPYSQTGRVDSSFYSTVSMLRSIEDIVGIRPLTQFDTFANPMSNSFTSKPSLTPYTAVRPADAGNILNGANAPMAAQSAAQP… |
| A0A518GUN6 | 674-806 | NGFDHVDGHRSICLVASPYTKRGEVISEFYNQTSVLHTMERILGLPPMNQMDAMSPLMSACFADEPDLTPYEALPANIPLDELNKPV… |
| A0A535BQL0 | 171-361 | None |
| A0A2V8C7Q7 | 7-110 | None |
| A0A258KDT9 | 1-104 | None |
| A0A7V9T4N4 | 451-592 | None |
| A0A519BA53 | 149-273 | None |
| A0A1F2U1N9 | 124-268 | None |
| A0A2V7JCV9 | 55-188 | None |
| A0A2V8X795 | 113-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.