DPCstruct | MC62800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0XST4 | 1-93 | MAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGLRMRGAPKQKIIIYKKAFPVLRYFKFWCSTPCLVFEASVM… |
| A0A453GSC9 | 122-212 | IFSRLPRWVGELAQLRILKIAVKELSKEDTDILKGLPALAVLSLHVMTTSPEMIVFGKGGFSVLIYFKFTCTVPWLKFEENAMPNLQ… |
| A0A6G1F4N2 | 236-314 | None |
| A0A3B6LRN7 | 344-434 | None |
| A0A453LFZ2 | 582-659 | None |
| A0A811RHJ3 | 187-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.