DPCstruct | MC6280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 167 ± 37 aa |
| Standard deviation of domain lengths | 37.20 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2GHX5 | 31-205 | KDTLSILDAKLSRKLSVSIRGAYNPNKLQPDLTSAHFGQCIDIKMKNMSDSIINVVLRCGTMLLSRDSSSQNMVVTKTLFYTLRPKE… |
| A0A7C3IN35 | 31-187 | FEPTGSPFSLNPGITLIAIAGDRQHFSPNGLYSLALVARANNSAYASDTLPGGLLFTSSKNSTQHMIILKDHPVTFSTNNTTVVLGV… |
| A0A3M1TPT2 | 126-292 | None |
| A0A348PMH1 | 33-208 | None |
| A0A523EDP1 | 642-820 | None |
| A0A3M1U8V0 | 22-177 | None |
| A0A7C4BHP0 | 2-161 | None |
| A0A2A2AM74 | 50-214 | None |
| A0A7V3UN81 | 33-222 | None |
| A0A518ARR2 | 40-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.