DPCstruct | MC628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 22 aa |
| Standard deviation of domain lengths | 22.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9CBK8 | 79-221 | DTGYTPWDPAVDAEPTSVNIMRYRFGWPMRMLHYDDISTGSSIADPIVLAYHQRAYQLAGNHRGLDRPGWVPGFIPLYRVPTVIRWD… |
| A0A7Y2HYT6 | 60-181 | TRNMDPELRAVCDARFGFPFKTMKFEFWGSITDGGHYVHVLPAKGVIQPFLRDPGRLVPTRVLPLGFAVSTTFYALLLGVGYVAVSA… |
| A0A166SJ27 | 3-151 | None |
| B0BIK1 | 49-205 | None |
| A0A3L7TBA2 | 72-266 | None |
| A0A166W5E0 | 52-191 | None |
| A0A7Y3UD39 | 1-129 | None |
| A0A2D9C6I3 | 57-232 | None |
| A0A523NG33 | 28-196 | None |
| A0A3D4UIN0 | 28-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.