DPCstruct | MC62797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 141 ± 25 aa |
| Standard deviation of domain lengths | 25.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 98.95 |
| Assigned Pfam label(s) | CL0329- PF00572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7PPD3 | 114-250 | AEDHVNTEKTWYVVDATDKILGRMASAIAVHIRGKNLPTYTPSVDMGAFVIVVNAEKVAVSGKKRLQKLYRRHSGRPGGMTVETFDQ… |
| A0A0P0XC97 | 22-165 | INLDGLRWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENGDMCVVLNAKDISVTGRKMTDKIYYWHTGYIGHLKERRLKDQME… |
| A0A1X6PD46 | 64-216 | None |
| A0A1R3K9B4 | 19-128 | None |
| A0A2N9IQT6 | 684-819 | None |
| A0A6V8DRE7 | 2-133 | None |
| A0A7W0P547 | 8-150 | None |
| A0A2R6D3C5 | 95-221 | None |
| A0A2H4SW77 | 393-563 | None |
| A0A5J4Z5K8 | 16-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.