DPCstruct | MC62795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0X5Y1 | 1-96 | EEVKDGVEVCVFDESPEVFSRAVHAISELTAGEPEPNFPDAEVERLASSITFLREWRHLSYEPKNVSFTCDARSAPSRVDTHKINLP… |
| F4HP69 | 1-122 | MDGEECNISLFDYSAESHLKAVESITDLCGEANADIDENDINILSSSVTFLREWRHYNFEPKSFAFYNEAEKNHQPKDINSQTLPQF… |
| A0A1D6N6R9 | 1-141 | None |
| A0A6A3CCT2 | 2-112 | None |
| A0A2N9IET7 | 57-175 | None |
| A0A2P5E0A3 | 58-216 | None |
| A0A5N5LT81 | 53-182 | None |
| A0A453FZ27 | 11-139 | None |
| A0A0L9VNZ8 | 40-155 | None |
| A0A2I0W6L8 | 15-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.