DPCstruct | MC62794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0X3V0 | 1-97 | MLVAAAAHSPASTALPRRRRRAAAPPSRKTPESQALRSILHSRVIACLRAQDGETAMQAARAAVRGGVSVLEIVMSTPGALEVIGDL… |
| C0HDU1 | 1-98 | MRVAASQLPLPTTTPARRRRRASAPPTAAPRPPPRALAAILRSRVIACLRAQDSETALQAAHAAVHGGITVLEVVMTTPGVLEVIED… |
| A0A4U6VTG8 | 1-99 | None |
| A0A2R6XSR9 | 73-176 | None |
| A0A1U7WQV2 | 9-104 | None |
| A0A7J6H1H6 | 11-105 | None |
| A0A5D2XQB3 | 7-115 | None |
| A0A6J1GZ74 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.