DPCstruct | MC62792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0398 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804RL32 | 1-103 | MDAYAPKDLLVVTTGSQGEPRAALNLASYGGSHTLKLSKEDVLLYSAKVIPGNETRVMKMMNRLTDLGPKIIMGKDSGLHTSGHAYR… |
| A0A7J2KM63 | 1-78 | PGSILDRLARNKLPFQFKPNDNIIFSSKTIPVPISMANKEQMDKRLKKTGARLFDNVHVSGHCGREDIRDLLTLINPE |
| A0A7C1A6S3 | 16-137 | None |
| T0DR00 | 106-209 | None |
| A0A6H0V339 | 273-383 | None |
| A0A0F6TDQ3 | 360-463 | None |
| A0A554JDL5 | 551-655 | None |
| A0A0D3BFF6 | 385-489 | None |
| A0A843H9K3 | 14-115 | None |
| A0A7J6VSG8 | 212-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.