DPCstruct | MC62789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 196 ± 25 aa |
| Standard deviation of domain lengths | 25.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 20.91 |
| Pfam Score | 90.04 |
| Assigned Pfam label(s) | CL0220- PF02179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804R297 | 25-221 | APTSKDGQKVQAASTTVGDQQNAALKSIEEDHVQENAGAGSLNGCDKRKNEDGTVIESETAKDDARTYGVNLSESDAAVRIQSAYRG… |
| A0A6A1UML3 | 1-158 | MDSPFRTNRWNFPSSATGIRAQPKATPSRKVVSIPVHFVGSERSRSDSALKIQKVFRGFLVRKSVRKIAALRSEVDEIEKKISEKET… |
| A0A6J5WFJ5 | 5-208 | None |
| A0A078HW64 | 411-620 | None |
| A0A4S8IQJ3 | 53-268 | None |
| A0A6V7QXI9 | 2-205 | None |
| A0A7R9PSI0 | 84-272 | None |
| A0A4Y7NG49 | 121-303 | None |
| A0A1Q3DEV6 | 1-175 | None |
| A0A834MHA2 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.