DPCstruct | MC62781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6WAU0 | 24-160 | ADFFATISCTAQHGNFQRLFLDLTRAHARLDFPSGSTLVTGAAHVAHDLYNSKRPDLEAFQAICPKVTLSFQQQIFGEFSFRIDSSL… |
| A0A2E7MJA4 | 1-127 | MEFSFGPSLTIGNYRNNFLDYTFIQSLLTITSKSGSSPFKFDNVNDELKLYLNLNQQLIKSLSLGFSSYLNIDKNSDKYNQFINTKY… |
| A0A835JRF9 | 331-466 | None |
| D7MWN0 | 296-435 | None |
| A0A5N5FD99 | 988-1125 | None |
| A0A1D6MPH5 | 351-482 | None |
| B7FFQ0 | 21-183 | None |
| A0A6V7PSQ7 | 335-465 | None |
| A0A832H107 | 1-118 | None |
| A0A1R3G5M4 | 613-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.