DPCstruct | MC62775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166AR23 | 150-222 | TELLDHLESVPAIEPVSVKSGLNIMEVIPQGVSKGLVAERLLETMQTKVMLPDVLCVGDDRSDDDMFEVIMSA |
| A0A0A9RJ59 | 1-92 | MLDHLESVLANEPVSVKNGQFIVEVKPQGVNKGIVAEKILTLMKDKGRPADFVLCIGDDRSDEDMFENIADVMKRSIVAPKSPLFAC… |
| A0A7J7IQF0 | 126-200 | None |
| A0A7J6TW91 | 88-163 | None |
| A0A812MQN0 | 18-87 | None |
| A0A0W8DCR4 | 509-579 | None |
| A0A6V2WP16 | 101-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.